PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004494503.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family MYB
Protein Properties Length: 360aa    MW: 41019.5 Da    PI: 7.403
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004494503.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.51.5e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l+++++++G g+W+++++  g+ R++k+c++rw +yl
   XP_004494503.1 14 KGLWSPEEDEKLLNYITKHGHGCWSSVPKLAGLQRCGKSCRLRWINYL 61
                     678*******************************************97 PP

2Myb_DNA-binding422.1e-1367110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+++++E+  ++++++ lG++ W+ Ia+ ++ gRt++++k+ w++
   XP_004494503.1  67 RGAFSQQEENSIIELHAVLGNR-WSQIAAQLP-GRTDNEIKNLWNS 110
                      89********************.*********.*********9985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.1E-27664IPR009057Homeodomain-like
PROSITE profilePS5129425.407965IPR017930Myb domain
SuperFamilySSF466893.19E-2912108IPR009057Homeodomain-like
SMARTSM007172.2E-131363IPR001005SANT/Myb domain
PfamPF002492.5E-161461IPR001005SANT/Myb domain
CDDcd001676.81E-121761No hitNo description
Gene3DG3DSA:1.10.10.601.0E-2465116IPR009057Homeodomain-like
PROSITE profilePS5129418.65366116IPR017930Myb domain
SMARTSM007171.3E-1166114IPR001005SANT/Myb domain
PfamPF002492.3E-1267110IPR001005SANT/Myb domain
CDDcd001675.80E-869112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 360 aa     Download sequence    Send to blast
MGRHSCCYKQ KLRKGLWSPE EDEKLLNYIT KHGHGCWSSV PKLAGLQRCG KSCRLRWINY  60
LRPDLKRGAF SQQEENSIIE LHAVLGNRWS QIAAQLPGRT DNEIKNLWNS SLKKKLRQNG  120
IDPNTHQPLS QLEVENKDKD NKPSSSDKSN NLFLSNSITM DPNYPLEISS TSKINNNRST  180
NQELFLDHNL VGLGGCFSFH QLNYGINNME LSPNSNNNSL CFIPGSSSSS QMMSELNSST  240
MLHSVFQTPN TKHVDGIQQQ QQNNNYYDHA HQVEDIKWCE YLNAPFFVGN NTVQHQTTAT  300
YSDNIMNNDV KQETGFITDE SSSNTNTWQH HNQHFQLSAS SDIYSKDLLQ RFSLAFGQTL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-28121165108B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1111117LKKKLRQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004494503.10.0PREDICTED: myb-related protein 308-like
TrEMBLA0A0S3RZZ91e-142A0A0S3RZZ9_PHAAN; Uncharacterized protein
TrEMBLA0A0L9U9641e-142A0A0L9U964_PHAAN; Uncharacterized protein
STRINGGLYMA19G41250.11e-137(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF108333103
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09540.12e-76myb domain protein 61